Lineage for d5nx4b_ (5nx4 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (38 species)
    not a true protein
  7. 2338104Species Streptomyces clavuligerus [TaxId:1901] [339165] (2 PDB entries)
  8. 2338108Domain d5nx4b_: 5nx4 B: [339262]
    automated match to d5dz2a_
    complexed with gol

Details for d5nx4b_

PDB Entry: 5nx4 (more details), 2.38 Å

PDB Description: crystal structure of linalool/nerolidol synthase from streptomyces clavuligerus
PDB Compounds: (B:) pentalenene synthase

SCOPe Domain Sequences for d5nx4b_:

Sequence, based on SEQRES records: (download)

>d5nx4b_ a.128.1.0 (B:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
fefavpapsrvspdlarararhldwvhamdlvrgeearrryefscvadigaygyphatga
dldlcvdvlgwtflfddqfdagdgrerdalavcaeltdllwkgtaataasppivvafsdc
wermragmsdawrrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfa
laervggyevprrawhssrldgmrfttsdavigmnelhsfekdraqghanlvlslvhhgg
ltgpeavtrvcdlvqgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwg
r

Sequence, based on observed residues (ATOM records): (download)

>d5nx4b_ a.128.1.0 (B:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
fefavpapsrvspdlarararhldwvhamdlvyefscvadigaygyphatgadldlcvdv
lgwtflfddqfdrdalavcaeltdllwkgtaataasppivvafsdcwermragmsdawrr
rtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfalaervggyevprra
whssrldgmrfttsdavigmnelhsfekdraqghanlvlslvhhggltgpeavtrvcdlv
qgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwgr

SCOPe Domain Coordinates for d5nx4b_:

Click to download the PDB-style file with coordinates for d5nx4b_.
(The format of our PDB-style files is described here.)

Timeline for d5nx4b_: