SCOPe 2.07: Domain d1bxgb2: 1bxg B:401-548

Lineage for d1bxgb2 (1bxg B:401-548)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Phenylalanine dehydrogenase [53233] (1 species)

7. Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)

8. Domain d1bxgb2: 1bxg B:401-548 [33925]
   Other proteins in same PDB: d1bxga1, d1bxgb1
   complexed with hci, k, nad, po4

Details for d1bxgb2

PDB Entry: 1bxg, 2.3 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate

PDB Compounds: (B:) phenylalanine dehydrogenase

SCOPe Domain Sequences for d1bxgb2:

Sequence; same for both SEQRES and ATOM records:

>d1bxgb2 c.58.1.1 (B:401-548) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
sidsalnwdgemtvtrfdrmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

Timeline for d1bxgb2:

• d1bxgb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bxgb2 appears in SCOPe 2.06
  
• d1bxgb2 appears in the current release, SCOPe 2.08