Lineage for d1bxgb2 (1bxg B:401-548)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498098Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2498226Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 2498227Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 2498235Domain d1bxgb2: 1bxg B:401-548 [33925]
    Other proteins in same PDB: d1bxga1, d1bxgb1
    complexed with hci, k, nad, po4

Details for d1bxgb2

PDB Entry: 1bxg (more details), 2.3 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate
PDB Compounds: (B:) phenylalanine dehydrogenase

SCOPe Domain Sequences for d1bxgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxgb2 c.58.1.1 (B:401-548) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
sidsalnwdgemtvtrfdrmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOPe Domain Coordinates for d1bxgb2:

Click to download the PDB-style file with coordinates for d1bxgb2.
(The format of our PDB-style files is described here.)

Timeline for d1bxgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxgb1