Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d5mf4e_: 5mf4 E: [339106] Other proteins in same PDB: d5mf4a1, d5mf4a2, d5mf4b1, d5mf4b2, d5mf4c1, d5mf4c2, d5mf4d1, d5mf4d2, d5mf4f1, d5mf4f2, d5mf4f3 automated match to d4i55e_ complexed with 7lz, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5mf4 (more details), 2.3 Å
SCOPe Domain Sequences for d5mf4e_:
Sequence, based on SEQRES records: (download)
>d5mf4e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkee
>d5mf4e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk ee
Timeline for d5mf4e_: