Lineage for d1hwzc2 (1hwz C:1-208)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125088Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 125089Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 125090Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 125091Protein Glutamate dehydrogenase [53225] (6 species)
  7. 125117Species Cow (Bos taurus) [TaxId:9913] [53230] (3 PDB entries)
  8. 125126Domain d1hwzc2: 1hwz C:1-208 [33906]
    Other proteins in same PDB: d1hwza1, d1hwzb1, d1hwzc1, d1hwzd1, d1hwze1, d1hwzf1

Details for d1hwzc2

PDB Entry: 1hwz (more details), 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp

SCOP Domain Sequences for d1hwzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwzc2 c.58.1.1 (C:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1hwzc2:

Click to download the PDB-style file with coordinates for d1hwzc2.
(The format of our PDB-style files is described here.)

Timeline for d1hwzc2: