Lineage for d5y4fa_ (5y4f A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612557Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 2612558Protein automated matches [191267] (8 species)
    not a true protein
  7. 2612577Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)
  8. 2612614Domain d5y4fa_: 5y4f A: [339029]
    automated match to d1n11a_
    complexed with act, ca

Details for d5y4fa_

PDB Entry: 5y4f (more details), 1.95 Å

PDB Description: crystal structure of ankb ankyrin repeats r13-24 in complex with autoinhibition segment ai-c
PDB Compounds: (A:) Ankyrin-2

SCOPe Domain Sequences for d5y4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y4fa_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gltpihvaafmghlnivllllqngaspdvtnirgetalhmaaragqvevvrcllrngalv
darareeqtplhiasrlgkteivqlllqhmahpdaattngytplhisaregqvdvasvll
eagaahslatkkgftplhvaakygsldvaklllqrraaadsagkngltplhvaahydnqk
vallllekgasphatakngytplhiaakknqmqiastllnygaetnivtkqgvtplhlas
qeghtdmvtllldkganihmstksgltslhlaaqedkvnvadiltkhgadqdahtklgyt
plivachygnvkmvnfllkqganvnaktkngytplhqaaqqghthiinvllqhgakpnat
tangntalaiakrlgyisvvdtlkvvteevttttttitekhklnvpetmtevldv

SCOPe Domain Coordinates for d5y4fa_:

Click to download the PDB-style file with coordinates for d5y4fa_.
(The format of our PDB-style files is described here.)

Timeline for d5y4fa_: