Class b: All beta proteins [48724] (178 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [274562] (6 PDB entries) |
Domain d5tt3d_: 5tt3 D: [338970] automated match to d4ygfg_ complexed with cl, ezl, gol, zn |
PDB Entry: 5tt3 (more details), 2.2 Å
SCOPe Domain Sequences for d5tt3d_:
Sequence, based on SEQRES records: (download)
>d5tt3d_ b.74.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]} wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaet
>d5tt3d_ b.74.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]} wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyakavffthht lkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvlaigk enpnldpilegiqkkaldaflpksinyyhfngsltappctegvawfvieeplevsakqla epnqrpvqpdyntviikssaet
Timeline for d5tt3d_: