SCOPe 2.04: Domain d2tmgf2: 2tmg F:4-178

Lineage for d2tmgf2 (2tmg F:4-178)

Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
Protein Glutamate dehydrogenase [53225] (8 species)
Species Thermotoga maritima [TaxId:2336] [53229] (3 PDB entries)
Domain d2tmgf2: 2tmg F:4-178 [33891]
Other proteins in same PDB: d2tmga1, d2tmgb1, d2tmgc1, d2tmgd1, d2tmge1, d2tmgf1
mutant

Details for d2tmgf2

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

PDB Compounds: (F:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d2tmgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmgf2 c.58.1.1 (F:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvel

SCOPe Domain Coordinates for d2tmgf2:

Click to download the PDB-style file with coordinates for d2tmgf2.
(The format of our PDB-style files is described here.)

Timeline for d2tmgf2: