Lineage for d5h49a_ (5h49 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2049110Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2049111Protein automated matches [190873] (4 species)
    not a true protein
  7. 2049198Species Rattus norvegicus [TaxId:10116] [320477] (4 PDB entries)
  8. 2049204Domain d5h49a_: 5h49 A: [338889]
    automated match to d2wnvb_
    complexed with nag

Details for d5h49a_

PDB Entry: 5h49 (more details), 2.8 Å

PDB Description: crystal structure of cbln1
PDB Compounds: (A:) Cerebellin-1

SCOPe Domain Sequences for d5h49a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h49a_ b.22.1.0 (A:) automated matches {Rattus norvegicus [TaxId: 10116]}
sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv
vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg
gwkystfsgflvfpl

SCOPe Domain Coordinates for d5h49a_:

Click to download the PDB-style file with coordinates for d5h49a_.
(The format of our PDB-style files is described here.)

Timeline for d5h49a_: