Lineage for d5v2cx_ (5v2c X:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632179Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2632180Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2632184Protein automated matches [267680] (2 species)
    not a true protein
  7. 2632198Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries)
  8. 2632205Domain d5v2cx_: 5v2c X: [338865]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cz_
    automated match to d4il6x_
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd

Details for d5v2cx_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d5v2cx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2cx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mtitpslkgffigllsgavvlgltfavliaisqidkvqrs

SCOPe Domain Coordinates for d5v2cx_:

Click to download the PDB-style file with coordinates for d5v2cx_.
(The format of our PDB-style files is described here.)

Timeline for d5v2cx_: