Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) Pfam PF06596 |
Family f.23.40.1: PsbX-like [267615] (2 proteins) |
Protein automated matches [267680] (2 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries) |
Domain d5v2cx_: 5v2c X: [338865] Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cz_ automated match to d4il6x_ complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd |
PDB Entry: 5v2c (more details), 1.9 Å
SCOPe Domain Sequences for d5v2cx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v2cx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mtitpslkgffigllsgavvlgltfavliaisqidkvqrs
Timeline for d5v2cx_: