Lineage for d5vb0f1 (5vb0 F:1-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2549990Species Escherichia coli [TaxId:562] [338723] (1 PDB entry)
  8. 2549996Domain d5vb0f1: 5vb0 F:1-138 [338755]
    Other proteins in same PDB: d5vb0a2, d5vb0c2, d5vb0f2, d5vb0h2
    automated match to d4jh2a_
    complexed with mn, ni

Details for d5vb0f1

PDB Entry: 5vb0 (more details), 2.69 Å

PDB Description: crystal structure of fosfomycin resistance protein fosa3
PDB Compounds: (F:) Fosfomycin resistance protein FosA3

SCOPe Domain Sequences for d5vb0f1:

Sequence, based on SEQRES records: (download)

>d5vb0f1 d.32.1.0 (F:1-138) automated matches {Escherichia coli [TaxId: 562]}
mlqglnhltlavsdlasslafyqqlpgmrlhaswdsgaylscgalwlclsldeqrrktpp
qesdythyafsvaeeefagvvallaqagaevwkdnrsegasyyfldpdghklelhvgnla
qrlaacrerpykgmvffd

Sequence, based on observed residues (ATOM records): (download)

>d5vb0f1 d.32.1.0 (F:1-138) automated matches {Escherichia coli [TaxId: 562]}
mlqglnhltlavsdlasslafyqqlpgmrlhaswdsgaylscgalwlclsldeqrrktpp
qesdythyafsvaeeefagvvallaqagaevwkdnasyyfldpdghklelhvgnlaqrla
acrerpykgmvffd

SCOPe Domain Coordinates for d5vb0f1:

Click to download the PDB-style file with coordinates for d5vb0f1.
(The format of our PDB-style files is described here.)

Timeline for d5vb0f1: