Lineage for d1aupa2 (1aup A:1-192)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1174487Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1174488Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 1174489Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 1174490Protein Glutamate dehydrogenase [53225] (8 species)
  7. 1174491Species Clostridium symbiosum [TaxId:1512] [53226] (4 PDB entries)
  8. 1174497Domain d1aupa2: 1aup A:1-192 [33870]
    Other proteins in same PDB: d1aupa1

Details for d1aupa2

PDB Entry: 1aup (more details), 2.5 Å

PDB Description: glutamate dehydrogenase
PDB Compounds: (A:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d1aupa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aupa2 c.58.1.1 (A:1-192) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]}
skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
rvpweddngkvhvntgyrvqfngaigpylgglrfapsvnlsimkflgfeqafkdslttlp
mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
rkivggfyngvl

SCOPe Domain Coordinates for d1aupa2:

Click to download the PDB-style file with coordinates for d1aupa2.
(The format of our PDB-style files is described here.)

Timeline for d1aupa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aupa1