Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [338697] (3 PDB entries) |
Domain d5v3db_: 5v3d B: [338698] automated match to d4jh2a_ complexed with edo, fcn, k, mn, peg |
PDB Entry: 5v3d (more details), 1.54 Å
SCOPe Domain Sequences for d5v3db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v3db_ d.32.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} mlsglnhltlavsqlapsvafyqqllgmtlharwdsgaylscgdlwlclsldpqrrvtpp eesdythyafsiseadfasfaarleaagvavwklnrsegashyfldpdghklelhvgsla qrlaacreqpykgmvff
Timeline for d5v3db_: