SCOPe 2.08: Domain d5o4ed2: 5o4e D:340-450

Lineage for d5o4ed2 (5o4e D:340-450)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5o4ed2: 5o4e D:340-450 [338624]
   Other proteins in same PDB: d5o4ea1, d5o4ea2, d5o4eb1, d5o4ec1, d5o4ec2, d5o4ed1, d5o4ee_, d5o4ef_
   automated match to d1hzhh4
   complexed with cac, mpd, mrd, trs

Details for d5o4ed2

PDB Entry: 5o4e, 2.15 Å

PDB Description: crystal structure of vegf in complex with heterodimeric fcab janusct6

PDB Compounds: (D:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5o4ed2:

Sequence; same for both SEQRES and ATOM records:

>d5o4ed2 b.1.1.0 (D:340-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvyvyppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnyktt
ppvldsdgsfalvskltvpypswlmgtrfscsvmhealhnhytqkhleyqw

Timeline for d5o4ed2:

• d5o4ed2 first appeared in SCOPe 2.06
  
• d5o4ed2 appears in SCOPe 2.07