Lineage for d5o4ed2 (5o4e D:340-450)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755348Domain d5o4ed2: 5o4e D:340-450 [338624]
    Other proteins in same PDB: d5o4ea1, d5o4ea2, d5o4eb1, d5o4ec1, d5o4ec2, d5o4ed1, d5o4ee_, d5o4ef_
    automated match to d1hzhh4
    complexed with cac, mpd, mrd, trs

Details for d5o4ed2

PDB Entry: 5o4e (more details), 2.15 Å

PDB Description: crystal structure of vegf in complex with heterodimeric fcab janusct6
PDB Compounds: (D:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5o4ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o4ed2 b.1.1.0 (D:340-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvyvyppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnyktt
ppvldsdgsfalvskltvpypswlmgtrfscsvmhealhnhytqkhleyqw

SCOPe Domain Coordinates for d5o4ed2:

Click to download the PDB-style file with coordinates for d5o4ed2.
(The format of our PDB-style files is described here.)

Timeline for d5o4ed2: