Lineage for d5o4ed1 (5o4e D:237-339)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750327Domain d5o4ed1: 5o4e D:237-339 [338623]
    Other proteins in same PDB: d5o4eb2, d5o4ed2, d5o4ee_, d5o4ef_
    automated match to d1hzhh3
    complexed with cac, mpd, mrd, trs

Details for d5o4ed1

PDB Entry: 5o4e (more details), 2.15 Å

PDB Description: crystal structure of vegf in complex with heterodimeric fcab janusct6
PDB Compounds: (D:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5o4ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o4ed1 b.1.1.2 (D:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5o4ed1:

Click to download the PDB-style file with coordinates for d5o4ed1.
(The format of our PDB-style files is described here.)

Timeline for d5o4ed1: