Lineage for d5oa5a_ (5oa5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779929Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)
  7. 2779962Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (22 PDB entries)
  8. 2779985Domain d5oa5a_: 5oa5 A: [338594]
    automated match to d1q2ba_
    complexed with gol, nag

Details for d5oa5a_

PDB Entry: 5oa5 (more details), 2.1 Å

PDB Description: cellobiohydrolase i (cel7a) from hypocrea jecorina with improved thermal stability
PDB Compounds: (A:) exoglucanase 1

SCOPe Domain Sequences for d5oa5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oa5a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqpethppltwqkcssggtctqqtgsvvidanwrwihatnsstscydgntwsstl
cpdnetctknccldgaayastygvttsgdsltigfvtqsaqknvgarlylmandttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepstnnantgigghgsccsemdiweansisealtlhpcttvgqeiceg
dgcggtysknryggpcdpdgcdwnpyrlgntsfygpgpsftldttkkltvvtqfkpsgai
nryyvqngvtfqqpnaelgsysgnelnddycyaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgdpaqvesqfpnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d5oa5a_:

Click to download the PDB-style file with coordinates for d5oa5a_.
(The format of our PDB-style files is described here.)

Timeline for d5oa5a_: