PDB entry 5oa5

View 5oa5 on RCSB PDB site
Description: cellobiohydrolase I (cel7a) from hypocrea jecorina with improved thermal stability
Class: hydrolase
Keywords: hydrolase, cellulase, protein engineering
Deposited on 2017-06-20, released 2017-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exoglucanase 1
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: CBH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62694 (1-433)
      • engineered mutation (7)
      • engineered mutation (40)
      • engineered mutation (48)
      • engineered mutation (67)
      • engineered mutation (88)
      • engineered mutation (91)
      • engineered mutation (112)
      • engineered mutation (195)
      • engineered mutation (226)
      • engineered mutation (248)
      • engineered mutation (254)
      • engineered mutation (277)
      • engineered mutation (294-295)
      • engineered mutation (331)
      • engineered mutation (402)
      • engineered mutation (410)
    Domains in SCOPe 2.08: d5oa5a_
  • Chain 'B':
    Compound: exoglucanase 1
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: CBH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62694 (1-433)
      • engineered mutation (7)
      • engineered mutation (40)
      • engineered mutation (48)
      • engineered mutation (67)
      • engineered mutation (88)
      • engineered mutation (91)
      • engineered mutation (112)
      • engineered mutation (195)
      • engineered mutation (226)
      • engineered mutation (248)
      • engineered mutation (254)
      • engineered mutation (277)
      • engineered mutation (294-295)
      • engineered mutation (331)
      • engineered mutation (402)
      • engineered mutation (410)
    Domains in SCOPe 2.08: d5oa5b_
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oa5A (A:)
    esactlqpethppltwqkcssggtctqqtgsvvidanwrwihatnsstscydgntwsstl
    cpdnetctknccldgaayastygvttsgdsltigfvtqsaqknvgarlylmandttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepstnnantgigghgsccsemdiweansisealtlhpcttvgqeiceg
    dgcggtysknryggpcdpdgcdwnpyrlgntsfygpgpsftldttkkltvvtqfkpsgai
    nryyvqngvtfqqpnaelgsysgnelnddycyaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgdpaqvesqfpnakvtfsn
    ikfgpigstgnpsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oa5B (B:)
    esactlqpethppltwqkcssggtctqqtgsvvidanwrwihatnsstscydgntwsstl
    cpdnetctknccldgaayastygvttsgdsltigfvtqsaqknvgarlylmandttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepstnnantgigghgsccsemdiweansisealtlhpcttvgqeiceg
    dgcggtysknryggpcdpdgcdwnpyrlgntsfygpgpsftldttkkltvvtqfkpsgai
    nryyvqngvtfqqpnaelgsysgnelnddycyaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgdpaqvesqfpnakvtfsn
    ikfgpigstgnpsg