Lineage for d5ocsb_ (5ocs B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091860Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2091861Protein automated matches [190048] (21 species)
    not a true protein
  7. 2091917Species Cupriavidus metallidurans [TaxId:119219] [338590] (1 PDB entry)
  8. 2091918Domain d5ocsb_: 5ocs B: [338592]
    automated match to d3hgja_
    complexed with act, cit, fmn

Details for d5ocsb_

PDB Entry: 5ocs (more details), 1.7 Å

PDB Description: ene-reductase (er/oye) from ralstonia (cupriavidus) metallidurans
PDB Compounds: (B:) Putative NADH-depentdent flavin oxidoreductase

SCOPe Domain Sequences for d5ocsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocsb_ c.1.4.0 (B:) automated matches {Cupriavidus metallidurans [TaxId: 119219]}
mphlfdpyrignlelanriaiapmcqysaqegnatdwhmihlgqmalsgaglliieatav
spegritptdlglyndaneaalgrvlgavrnhspiavtiqlahagrkasseapwdgggqi
rpdqprgwqtfapsavphaagevppaaldkagmkkirddfvaaakraarlgiegievhga
hgyllhqflspianhrtdeyggslenrmrfplevfdavreafpaerpvwmrvsatdwvpn
gwdiegtialshelkargsaavhvstggvspqqaikigpgyqvpyaqrvkaevglptmav
gliteaeqaeaiianneadiisiaramlydprwpwhaaaklgasvnapkqywrsqprgle
klfkdahfgqr

SCOPe Domain Coordinates for d5ocsb_:

Click to download the PDB-style file with coordinates for d5ocsb_.
(The format of our PDB-style files is described here.)

Timeline for d5ocsb_: