Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (21 species) not a true protein |
Species Cupriavidus metallidurans [TaxId:119219] [338590] (1 PDB entry) |
Domain d5ocsb_: 5ocs B: [338592] automated match to d3hgja_ complexed with act, cit, fmn |
PDB Entry: 5ocs (more details), 1.7 Å
SCOPe Domain Sequences for d5ocsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ocsb_ c.1.4.0 (B:) automated matches {Cupriavidus metallidurans [TaxId: 119219]} mphlfdpyrignlelanriaiapmcqysaqegnatdwhmihlgqmalsgaglliieatav spegritptdlglyndaneaalgrvlgavrnhspiavtiqlahagrkasseapwdgggqi rpdqprgwqtfapsavphaagevppaaldkagmkkirddfvaaakraarlgiegievhga hgyllhqflspianhrtdeyggslenrmrfplevfdavreafpaerpvwmrvsatdwvpn gwdiegtialshelkargsaavhvstggvspqqaikigpgyqvpyaqrvkaevglptmav gliteaeqaeaiianneadiisiaramlydprwpwhaaaklgasvnapkqywrsqprgle klfkdahfgqr
Timeline for d5ocsb_: