SCOPe 2.06: Domain d6aqgc1: 6aqg C:7-153

Lineage for d6aqgc1 (6aqg C:7-153)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (33 species)
   not a true protein

7. Species Mycobacterium ulcerans [TaxId:362242] [334392] (2 PDB entries)

8. Domain d6aqgc1: 6aqg C:7-153 [338448]
   Other proteins in same PDB: d6aqga2, d6aqgb2, d6aqgc2, d6aqgd2
   automated match to d3bjua1
   protein/RNA complex; complexed with krs, lys, mpd

Details for d6aqgc1

PDB Entry: 6aqg, 2.25 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium ulcerans complexed with l-lysine and cladosporin

PDB Compounds: (C:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6aqgc1:

Sequence; same for both SEQRES and ATOM records:

>d6aqgc1 b.40.4.0 (C:7-153) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
nipeqfrirrdkrarllaegydpypvaierthtlaeiratyadlptdsatedivgvagrv
vfarntgklcfatlqdgdgtqlqamisldevgresldrwkadvdigdvvyvhgtvissrr
gelsvladswrmaakalrplpvahkem

Timeline for d6aqgc1:

• d6aqgc1 is new in SCOPe 2.06-stable
  
• d6aqgc1 appears in SCOPe 2.07
  
• d6aqgc1 appears in the current release, SCOPe 2.08