![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins) adopts thermolysin-like fold |
![]() | Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64340] (58 PDB entries) Uniprot P09960 |
![]() | Domain d5niaa2: 5nia A:209-460 [338413] Other proteins in same PDB: d5niaa1, d5niaa3 automated match to d3u9wa2 complexed with zn; mutant |
PDB Entry: 5nia (more details), 1.76 Å
SCOPe Domain Sequences for d5niaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5niaa2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpnvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d5niaa2: