SCOPe 2.08: Domain d1cp6a_: 1cp6 A:

Lineage for d1cp6a_ (1cp6 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Aeromonas proteolytica [TaxId:671] [53206] (17 PDB entries)
   Uniprot Q01693
   synonym: Vibrio proteolyticus

8. Domain d1cp6a_: 1cp6 A: [33838]
   complexed with bub, zn

Details for d1cp6a_

PDB Entry: 1cp6, 1.9 Å

PDB Description: 1-butaneboronic acid binding to aeromonas proteolytica aminopeptidase

PDB Compounds: (A:) protein (aminopeptidase)

SCOPe Domain Sequences for d1cp6a_:

Sequence; same for both SEQRES and ATOM records:

>d1cp6a_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

Timeline for d1cp6a_:

• d1cp6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cp6a_ appears in SCOPe 2.07