Lineage for d5vw3a1 (5vw3 A:8-156)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403245Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2403246Protein automated matches [226870] (22 species)
    not a true protein
  7. 2403304Species Maize (Zea mays) [TaxId:4577] [226539] (17 PDB entries)
  8. 2403309Domain d5vw3a1: 5vw3 A:8-156 [338345]
    Other proteins in same PDB: d5vw3a2
    automated match to d3lvba1
    complexed with act, fad, mg, nap; mutant

Details for d5vw3a1

PDB Entry: 5vw3 (more details), 1.45 Å

PDB Description: nadp+ soak of y316s mutant of corn root ferredoxin:nadp+ reductase
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5vw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vw3a1 b.43.4.0 (A:8-156) automated matches {Maize (Zea mays) [TaxId: 4577]}
skvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvpyw
egqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgked
pskngvcsnflcnskpgdkiqltgpsgki

SCOPe Domain Coordinates for d5vw3a1:

Click to download the PDB-style file with coordinates for d5vw3a1.
(The format of our PDB-style files is described here.)

Timeline for d5vw3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vw3a2