Lineage for d5vw5a2 (5vw5 A:157-316)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2468165Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2468166Protein automated matches [226871] (19 species)
    not a true protein
  7. 2468205Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)
  8. 2468222Domain d5vw5a2: 5vw5 A:157-316 [338338]
    Other proteins in same PDB: d5vw5a1
    automated match to d3lo8a2
    complexed with fad, mg, nca; mutant

Details for d5vw5a2

PDB Entry: 5vw5 (more details), 1.95 Å

PDB Description: nicotinamide soak of y316a mutant of corn root ferredoxin:nadp+ reductase
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5vw5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vw5a2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhveva

SCOPe Domain Coordinates for d5vw5a2:

Click to download the PDB-style file with coordinates for d5vw5a2.
(The format of our PDB-style files is described here.)

Timeline for d5vw5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vw5a1