Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries) |
Domain d5vqxa2: 5vqx A:430-552 [338318] Other proteins in same PDB: d5vqxa1, d5vqxa3, d5vqxb_ automated match to d1dloa1 complexed with 9hy, so4 |
PDB Entry: 5vqx (more details), 2.4 Å
SCOPe Domain Sequences for d5vqxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vqxa2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klv
Timeline for d5vqxa2: