Lineage for d5vqxa2 (5vqx A:430-552)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495170Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)
  8. 2495177Domain d5vqxa2: 5vqx A:430-552 [338318]
    Other proteins in same PDB: d5vqxa1, d5vqxa3, d5vqxb_
    automated match to d1dloa1
    complexed with 9hy, so4

Details for d5vqxa2

PDB Entry: 5vqx (more details), 2.4 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with 2-chloro-n-(6-cyano-3-(2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-4-methylnaphthalen-1-yl)-n- methylacetamide (jlj686), a non-nucleoside inhibitor
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d5vqxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vqxa2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

SCOPe Domain Coordinates for d5vqxa2:

Click to download the PDB-style file with coordinates for d5vqxa2.
(The format of our PDB-style files is described here.)

Timeline for d5vqxa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d5vqxb_