Lineage for d5v2wa_ (5v2w A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611326Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 2611360Protein automated matches [323957] (1 species)
    not a true protein
  7. 2611361Species Salmonella typhi [TaxId:90370] [323958] (2 PDB entries)
  8. 2611364Domain d5v2wa_: 5v2w A: [338277]
    Other proteins in same PDB: d5v2wb2
    automated match to d1j6wb_
    complexed with zn

Details for d5v2wa_

PDB Entry: 5v2w (more details), 2.3 Å

PDB Description: crystal structure of a luxs from salmonella typhi
PDB Compounds: (A:) S-ribosylhomocysteine lyase

SCOPe Domain Sequences for d5v2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2wa_ d.185.1.2 (A:) automated matches {Salmonella typhi [TaxId: 90370]}
lldsfavdhtrmqapavrtaktmntphgdaitvfdlrfcipnkevmpekgihtlehlfag
fmrdhlngngveiidispmgcrtgfymsligtpdeqrvadawkaamadvlkvqdqnqipe
lnvyqcgtyqmhslseaqdiarhilerdvrvnsnkelalpkeklqel

SCOPe Domain Coordinates for d5v2wa_:

Click to download the PDB-style file with coordinates for d5v2wa_.
(The format of our PDB-style files is described here.)

Timeline for d5v2wa_: