Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) |
Protein Carboxypeptidase A [53189] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [53190] (25 PDB entries) |
Domain d1pytb_: 1pyt B: [33820] Other proteins in same PDB: d1pyta_, d1pytc_, d1pytd_ complexed with ca, zn |
PDB Entry: 1pyt (more details), 2.35 Å
SCOP Domain Sequences for d1pytb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pytb_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus)} arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti mehtlnnly
Timeline for d1pytb_: