Class b: All beta proteins [48724] (180 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins) automatically mapped to Pfam PF03145 |
Protein automated matches [190456] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries) |
Domain d5wzzd_: 5wzz D: [338099] automated match to d4ca1a_ complexed with zn |
PDB Entry: 5wzz (more details), 2.1 Å
SCOPe Domain Sequences for d5wzzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wzzd_ b.8.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmhqh ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn lginvtismc
Timeline for d5wzzd_: