Lineage for d5wzza_ (5wzz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773395Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins)
    automatically mapped to Pfam PF03145
  6. 2773404Protein automated matches [190456] (1 species)
    not a true protein
  7. 2773405Species Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries)
  8. 2773413Domain d5wzza_: 5wzz A: [338118]
    automated match to d4ca1a_
    complexed with zn

Details for d5wzza_

PDB Entry: 5wzz (more details), 2.1 Å

PDB Description: the siah e3 ubiquitin ligases promote wnt/ beta-catenin signaling through mediating wnt-induced axin degradation
PDB Compounds: (A:) E3 ubiquitin-protein ligase SIAH1

SCOPe Domain Sequences for d5wzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wzza_ b.8.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svlfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmhqh
ksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqli
gtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengn
lginvtismc

SCOPe Domain Coordinates for d5wzza_:

Click to download the PDB-style file with coordinates for d5wzza_.
(The format of our PDB-style files is described here.)

Timeline for d5wzza_: