Lineage for d5y34b_ (5y34 B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624868Species Hydrogenovibrio marinus [TaxId:28885] [189746] (3 PDB entries)
  8. 2624873Domain d5y34b_: 5y34 B: [338097]
    Other proteins in same PDB: d5y34a_, d5y34c_
    automated match to d3ayxb_
    complexed with 3ni, f3s, fco, gol, mg, o, sf3, sf4

Details for d5y34b_

PDB Entry: 5y34 (more details), 1.32 Å

PDB Description: membrane-bound respiratory [nife]-hydrogenase from hydrogenovibrio marinus in a ferricyanide-oxidized condition
PDB Compounds: (B:) Membrane-bound hydrogenase small subunit

SCOPe Domain Sequences for d5y34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y34b_ e.19.1.0 (B:) automated matches {Hydrogenovibrio marinus [TaxId: 28885]}
prtpviwlhglectccsesfirsahplakdvvlsmisldyddtlmaasghaaeaildeik
ekykgnyilavegnpplnqdgmsciiggrpfseqlkrmaddakaiiswgscaswgcvqaa
kpnptqatpvhkflgggydkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmf
ysqrihdkcyrrphfdagqfveewddegarkgyclykvgckgpttynacstvrwnggtsf
piqsghgcigcsedgfwdkgsfysrdtemnafg

SCOPe Domain Coordinates for d5y34b_:

Click to download the PDB-style file with coordinates for d5y34b_.
(The format of our PDB-style files is described here.)

Timeline for d5y34b_: