SCOPe 2.07: Domain d5x9gb1: 5x9g B:5-131

Lineage for d5x9gb1 (5x9g B:5-131)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families)
   made of short helices; approximately 2.5 helices per turn of superhelix
   automatically mapped to Pfam PF03448

5. Family a.118.26.0: automated matches [231669] (1 protein)
   not a true family

6. Protein automated matches [231679] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [338061] (1 PDB entry)

8. Domain d5x9gb1: 5x9g B:5-131 [338089]
   Other proteins in same PDB: d5x9ga2, d5x9gb2, d5x9gc2, d5x9gd2
   automated match to d2yvxa1
   complexed with atp, mg

Details for d5x9gb1

PDB Entry: 5x9g, 3 Å

PDB Description: crystal structure of the cytosolic domain of the mg2+ channel mgte in complex with atp

PDB Compounds: (B:) Magnesium transporter MgtE

SCOPe Domain Sequences for d5x9gb1:

Sequence; same for both SEQRES and ATOM records:

>d5x9gb1 a.118.26.0 (B:5-131) automated matches {Thermus thermophilus [TaxId: 300852]}
lavslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshl
speeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraeve
alaryee

Timeline for d5x9gb1:

• d5x9gb1 first appeared in SCOPe 2.06
  
• d5x9gb1 appears in the current release, SCOPe 2.08