Lineage for d2ctb__ (2ctb -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) Protein Carboxypeptidase A [53189] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53190] (17 PDB entries) 
Domain d2ctb__: 2ctb - [33803]
Details for d2ctb__
PDB Entry: 2ctb (more details), 1.5 Å
PDB Description: the high resolution crystal structure of the complex between carboxypeptidase a and l-phenyl lactate
SCOP Domain Sequences for d2ctb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctb__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtlnn
SCOP Domain Coordinates for d2ctb__:
Click to download the PDB-style file with coordinates for d2ctb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ctb__:
- d2ctb__ first appeared (with stable ids) in SCOP 1.55
- d2ctb__ appears in SCOP 1.59
- d2ctb__ appears in the current release, SCOPe 2.08, called d2ctba_
View in 3D