Lineage for d2ctb__ (2ctb -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25553Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 25554Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 25555Protein Carboxypeptidase A [53189] (3 species)
  7. 25556Species Cow (Bos taurus) [TaxId:9913] [53190] (17 PDB entries)
  8. 25558Domain d2ctb__: 2ctb - [33803]

Details for d2ctb__

PDB Entry: 2ctb (more details), 1.5 Å

PDB Description: the high resolution crystal structure of the complex between carboxypeptidase a and l-phenyl lactate

SCOP Domain Sequences for d2ctb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctb__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtlnn

SCOP Domain Coordinates for d2ctb__:

Click to download the PDB-style file with coordinates for d2ctb__.
(The format of our PDB-style files is described here.)

Timeline for d2ctb__: