Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) |
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) |
Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (1 PDB entry) |
Domain d1augb_: 1aug B: [33799] |
PDB Entry: 1aug (more details), 2 Å
SCOP Domain Sequences for d1augb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1augb_ c.56.4.1 (B:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens} mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks apslsldhitkalkiaavtaavheddietg
Timeline for d1augb_: