Lineage for d1augb_ (1aug B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25540Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) (S)
  5. 25541Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein)
  6. 25542Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (2 species)
  7. 25543Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (1 PDB entry)
  8. 25545Domain d1augb_: 1aug B: [33799]

Details for d1augb_

PDB Entry: 1aug (more details), 2 Å

PDB Description: crystal structure of the pyroglutamyl peptidase i from bacillus amyloliquefaciens

SCOP Domain Sequences for d1augb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1augb_ c.56.4.1 (B:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens}
mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
apslsldhitkalkiaavtaavheddietg

SCOP Domain Coordinates for d1augb_:

Click to download the PDB-style file with coordinates for d1augb_.
(The format of our PDB-style files is described here.)

Timeline for d1augb_: