SCOPe 2.08: Domain d5vvga_: 5vvg A:

Lineage for d5vvga_ (5vvg A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
   Uniprot P29473 67-482

8. Domain d5vvga_: 5vvg A: [337978]
   automated match to d3e7sa_
   complexed with 9pm, cl, gol, h4b, hem, zn

Details for d5vvga_

PDB Entry: 5vvg, 2.3 Å

PDB Description: structure of bovine endothelial nitric oxide synthase heme domain in complex with 4-(2-(((2-aminoquinolin-7-yl)methyl)amino)ethyl)-2- chlorobenzonitrile

PDB Compounds: (A:) Nitric oxide synthase, endothelial

SCOPe Domain Sequences for d5vvga_:

Sequence; same for both SEQRES and ATOM records:

>d5vvga_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d5vvga_:

• d5vvga_ first appeared in SCOPe 2.06
  
• d5vvga_ appears in SCOPe 2.07