Lineage for d3e7sa_ (3e7s A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3003151Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 3003159Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
    Uniprot P29473 67-482
  8. 3003256Domain d3e7sa_: 3e7s A: [158056]
    automated match to d1d0ca_
    complexed with at2, hec, zn

Details for d3e7sa_

PDB Entry: 3e7s (more details), 2.5 Å

PDB Description: Structure of bovine eNOS oxygenase domain with inhibitor AR-C95791
PDB Compounds: (A:) Nitric oxide synthase, endothelial

SCOPe Domain Sequences for d3e7sa_:

Sequence, based on SEQRES records: (download)

>d3e7sa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
rppegpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppa
eqllsqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrn
aprcvgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgd
friwnsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeap
elfvlppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymst
eigtrnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdh
haatvsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Sequence, based on observed residues (ATOM records): (download)

>d3e7sa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
rppegpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprkeqllsqardfin
qyyssikrsgsqaheerlevastgtyhlreselvfgakqawrnaprcvgriqwgklqvfd
ardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwnsqlvryagyrqq
dgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlppelvlevpleh
ptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrnlcdphrynile
dvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvsfmkhldneqka
rggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d3e7sa_:

Click to download the PDB-style file with coordinates for d3e7sa_.
(The format of our PDB-style files is described here.)

Timeline for d3e7sa_: