SCOPe 2.06: Domain d5lpma1: 5lpm A:1048-1161

Lineage for d5lpma1 (5lpm A:1048-1161)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)

8. Domain d5lpma1: 5lpm A:1048-1161 [337891]
   Other proteins in same PDB: d5lpma2, d5lpmb2
   automated match to d3i3je_
   complexed with 71y, act

Details for d5lpma1

PDB Entry: 5lpm, 1.5 Å

PDB Description: crystal structure of the bromodomain of human ep300 bound to the inhibitor xdm3d

PDB Compounds: (A:) Histone acetyltransferase p300

SCOPe Domain Sequences for d5lpma1:

Sequence; same for both SEQRES and ATOM records:

>d5lpma1 a.29.2.1 (A:1048-1161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg

Timeline for d5lpma1:

• d5lpma1 is new in SCOPe 2.06-stable
  
• d5lpma1 appears in SCOPe 2.07
  
• d5lpma1 appears in the current release, SCOPe 2.08