SCOPe 2.07: Domain d5llna_: 5lln A:

Lineage for d5llna_ (5lln A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (54 PDB entries)

8. Domain d5llna_: 5lln A: [337839]
   automated match to d3d0na_
   complexed with 3tv, cit, zn

Details for d5llna_

PDB Entry: 5lln, 1.6 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 2,3,5, 6-tetrafluoro-4-(propylthio)benzenesulfonamide

PDB Compounds: (A:) Carbonic anhydrase 13

SCOPe Domain Sequences for d5llna_:

Sequence; same for both SEQRES and ATOM records:

>d5llna_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisns
ghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvh
wnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdll
sllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflv
snhrppqplkgrkvrasfh

Timeline for d5llna_:

• d5llna_ first appeared in SCOPe 2.06
  
• d5llna_ appears in the current release, SCOPe 2.08