SCOPe 2.06: Domain d5wauc_: 5wau C:

Lineage for d5wauc_ (5wau C:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries)

8. Domain d5wauc_: 5wau C: [337823]
   Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5waud_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauj_, d5wauk_, d5waul_, d5waum_
   automated match to d1v54c_
   complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn

Details for d5wauc_

PDB Entry: 5wau, 1.95 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by synchrotron x-ray crystallography at 100 k

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5wauc_:

Sequence; same for both SEQRES and ATOM records:

>d5wauc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d5wauc_:

• d5wauc_ is new in SCOPe 2.06-stable
  
• d5wauc_ appears in SCOPe 2.07
  
• d5wauc_ appears in the current release, SCOPe 2.08