Lineage for d5waub1 (5wau B:2-90)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024057Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 3024058Species Cow (Bos taurus) [TaxId:9913] [81454] (50 PDB entries)
  8. 3024125Domain d5waub1: 5wau B:2-90 [337619]
    Other proteins in same PDB: d5waua_, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5waui_, d5wauj_, d5wauk_, d5waul_, d5waum_
    automated match to d1v54b2
    complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn

Details for d5waub1

PDB Entry: 5wau (more details), 1.95 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by synchrotron x-ray crystallography at 100 k
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5waub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5waub1 f.17.2.1 (B:2-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
aypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqev
etiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d5waub1:

Click to download the PDB-style file with coordinates for d5waub1.
(The format of our PDB-style files is described here.)

Timeline for d5waub1: