Lineage for d5gqea1 (5gqe A:1-303)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. 2440011Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)
  8. 2440028Domain d5gqea1: 5gqe A:1-303 [337482]
    Other proteins in same PDB: d5gqea2, d5gqeb2
    automated match to d2d1za1
    complexed with xyp; mutant

Details for d5gqea1

PDB Entry: 5gqe (more details), 2.5 Å

PDB Description: crystal structure of michaelis complex of xylanase mutant (t82a, n127s, and e128h) from streptomyces olivaceoviridis e-86
PDB Compounds: (A:) Beta-xylanase

SCOPe Domain Sequences for d5gqea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gqea1 c.1.8.3 (A:1-303) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghalawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOPe Domain Coordinates for d5gqea1:

Click to download the PDB-style file with coordinates for d5gqea1.
(The format of our PDB-style files is described here.)

Timeline for d5gqea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gqea2