Lineage for d1e3ma3 (1e3m A:117-269)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1172975Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 1172976Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 1172977Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 1172978Species Escherichia coli [TaxId:562] [53154] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1172982Domain d1e3ma3: 1e3m A:117-269 [33746]
    Other proteins in same PDB: d1e3ma1, d1e3ma2, d1e3ma4, d1e3mb1, d1e3mb2, d1e3mb4
    complexed with adp, mg

Details for d1e3ma3

PDB Entry: 1e3m (more details), 2.2 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1e3ma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ma3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOPe Domain Coordinates for d1e3ma3:

Click to download the PDB-style file with coordinates for d1e3ma3.
(The format of our PDB-style files is described here.)

Timeline for d1e3ma3: