SCOPe 2.03: Domain d1ewra3: 1ewr A:131-266

Lineage for d1ewra3 (1ewr A:131-266)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family)

5. Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)

6. Protein DNA repair protein MutS, domain II [53152] (2 species)

7. Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries)

8. Domain d1ewra3: 1ewr A:131-266 [33744]
   Other proteins in same PDB: d1ewra1, d1ewra2, d1ewrb1, d1ewrb2

Details for d1ewra3

PDB Entry: 1ewr, 3.19 Å

PDB Description: crystal structure of taq muts

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ewra3:

Sequence, based on SEQRES records:

>d1ewra3 c.55.6.1 (A:131-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]}
anylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapellengaf
ldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqpfrfydpgafm
rlpeatlralevfepl

Sequence, based on observed residues (ATOM records):

>d1ewra3 c.55.6.1 (A:131-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]}
anylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapellengaf
ldefrkrseapfepegegplalrrargallayaqrtqggalslqpfrfydpgafmrlpea
tlralevfepl

Timeline for d1ewra3:

• d1ewra3 first appeared (with stable ids) in SCOP 1.55
  
• d1ewra3 appears in SCOPe 2.02
  
• d1ewra3 appears in SCOPe 2.04
  
• d1ewra3 appears in the current release, SCOPe 2.08