SCOP 1.55: Domain d1ewra3: 1ewr A:131-266

Lineage for d1ewra3 (1ewr A:131-266)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family)

5. Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)

6. Protein DNA repair protein MutS, domain II [53152] (2 species)

7. Species Thermus aquaticus [TaxId:271] [53153] (3 PDB entries)

8. Domain d1ewra3: 1ewr A:131-266 [33744]
   Other proteins in same PDB: d1ewra1, d1ewra2, d1ewrb1, d1ewrb2

Details for d1ewra3

PDB Entry: 1ewr, 3.19 Å

PDB Description: crystal structure of taq muts

SCOP Domain Sequences for d1ewra3:

Sequence, based on SEQRES records:

>d1ewra3 c.55.6.1 (A:131-266) DNA repair protein MutS, domain II {Thermus aquaticus}
anylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapellengaf
ldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqpfrfydpgafm
rlpeatlralevfepl

Sequence, based on observed residues (ATOM records):

>d1ewra3 c.55.6.1 (A:131-266) DNA repair protein MutS, domain II {Thermus aquaticus}
anylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapellengaf
ldefrkrseapfepegegplalrrargallayaqrtqggalslqpfrfydpgafmrlpea
tlralevfepl

Timeline for d1ewra3:

• d1ewra3 appears in SCOP 1.57
  
• d1ewra3 appears in the current release, SCOPe 2.08