| Class b: All beta proteins [48724] (180 folds) |
| Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
| Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
| Protein automated matches [227017] (58 species) not a true protein |
| Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (12 PDB entries) |
| Domain d5xl9a1: 5xl9 A:5-323 [337382] Other proteins in same PDB: d5xl9a2, d5xl9b2, d5xl9c2 automated match to d1ha0a1 complexed with nag, sia; mutant |
PDB Entry: 5xl9 (more details), 2.39 Å
SCOPe Domain Sequences for d5xl9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xl9a1 b.19.1.0 (A:5-323) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe
Timeline for d5xl9a1:
View in 3DDomains from other chains: (mouse over for more information) d5xl9b1, d5xl9b2, d5xl9c1, d5xl9c2 |