Lineage for d5xl9a2 (5xl9 A:333-499)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041948Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337345] (3 PDB entries)
  8. 3041954Domain d5xl9a2: 5xl9 A:333-499 [337383]
    Other proteins in same PDB: d5xl9a1, d5xl9b1, d5xl9c1
    automated match to d1ha0a2
    complexed with nag, sia; mutant

Details for d5xl9a2

PDB Entry: 5xl9 (more details), 2.39 Å

PDB Description: the structure of hemagglutinin g228s mutant from an avian-origin h4n6 influenza virus in complex with avian receptor analog lsta
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xl9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl9a2 h.3.1.0 (A:333-499) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
iagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektndkyhq
iekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrrq
lrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xl9a2:

Click to download the PDB-style file with coordinates for d5xl9a2.
(The format of our PDB-style files is described here.)

Timeline for d5xl9a2: