Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Yersinia pestis [TaxId:632] [337326] (2 PDB entries) |
Domain d5wifa_: 5wif A: [337347] Other proteins in same PDB: d5wifb2, d5wifc2 automated match to d4r9ma_ complexed with bo3, k, peg, pg5 |
PDB Entry: 5wif (more details), 2.5 Å
SCOPe Domain Sequences for d5wifa_:
Sequence, based on SEQRES records: (download)
>d5wifa_ d.108.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} svrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrfiiesq gtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklylivd kenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk
>d5wifa_ d.108.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} svrlrpleredlpfvhqldsimrywfeepyeafvelcdlydkhihdqserrfiiesqgtk iglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklylivdken ekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk
Timeline for d5wifa_:
View in 3D Domains from other chains: (mouse over for more information) d5wifb1, d5wifb2, d5wifc1, d5wifc2 |