Lineage for d5wifa_ (5wif A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2576220Species Yersinia pestis [TaxId:632] [337326] (2 PDB entries)
  8. 2576224Domain d5wifa_: 5wif A: [337347]
    Other proteins in same PDB: d5wifb2, d5wifc2
    automated match to d4r9ma_
    complexed with bo3, k, peg, pg5

Details for d5wifa_

PDB Entry: 5wif (more details), 2.5 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis
PDB Compounds: (A:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d5wifa_:

Sequence, based on SEQRES records: (download)

>d5wifa_ d.108.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
svrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrfiiesq
gtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklylivd
kenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk

Sequence, based on observed residues (ATOM records): (download)

>d5wifa_ d.108.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
svrlrpleredlpfvhqldsimrywfeepyeafvelcdlydkhihdqserrfiiesqgtk
iglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklylivdken
ekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk

SCOPe Domain Coordinates for d5wifa_:

Click to download the PDB-style file with coordinates for d5wifa_.
(The format of our PDB-style files is described here.)

Timeline for d5wifa_: