SCOPe 2.06: Domain d1hjrd_: 1hjr D:

Lineage for d1hjrd_ (1hjr D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.6: RuvC resolvase [53134] (1 protein)
   automatically mapped to Pfam PF02075

6. Protein RuvC resolvase [53135] (1 species)
   Holliday junction-specific endonuclease

7. Species Escherichia coli [TaxId:562] [53136] (1 PDB entry)

8. Domain d1hjrd_: 1hjr D: [33730]

Details for d1hjrd_

PDB Entry: 1hjr, 2.5 Å

PDB Description: atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli

PDB Compounds: (D:) holliday junction resolvase (ruvc)

SCOPe Domain Sequences for d1hjrd_:

Sequence; same for both SEQRES and ATOM records:

>d1hjrd_ c.55.3.6 (D:) RuvC resolvase {Escherichia coli [TaxId: 562]}
aiilgidpgsrvtgygvirqvgrqlsylgsgcirtkvddlpsrlkliyagvteiitqfqp
dyfaieqvfmaknadsalklgqargvaivaavnqelpvfeyaarqvkqtvvgigsaeksq
vqhmvrtllklpanpqadaadalaiaithchvsqnamq

Timeline for d1hjrd_:

• d1hjrd_ first appeared (with stable ids) in SCOP 1.55
  
• d1hjrd_ appears in SCOPe 2.05
  
• d1hjrd_ appears in SCOPe 2.07
  
• d1hjrd_ appears in the current release, SCOPe 2.08