Lineage for d1qqca1 (1qqc A:1-347)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488414Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 488631Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 488632Protein Exonuclease domain of family B DNA polymerases [53125] (7 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 488633Species Archaeon Desulfurococcus tok [TaxId:108142] [53130] (2 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold
  8. 488635Domain d1qqca1: 1qqc A:1-347 [33724]
    Other proteins in same PDB: d1qqca2

Details for d1qqca1

PDB Entry: 1qqc (more details), 2.6 Å

PDB Description: crystal structure of an archaebacterial dna polymerase d.tok

SCOP Domain Sequences for d1qqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqca1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Desulfurococcus tok}
mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
lidrglipmegdeelrmlafdietlyhegeefgegpilmisyadeegarvitwknidlpy
vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpkekvyaeeiarawe
sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrs

SCOP Domain Coordinates for d1qqca1:

Click to download the PDB-style file with coordinates for d1qqca1.
(The format of our PDB-style files is described here.)

Timeline for d1qqca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqca2