Lineage for d1qqca1 (1qqc A:1-347)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) 
Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species) 
Species Thermophilic archaebacterium (Desulfurococcus tok) [TaxId:108142] [53130] (2 PDB entries) 
Domain d1qqca1: 1qqc A:1-347 [33724]
Other proteins in same PDB: d1qqca2
Details for d1qqca1
PDB Entry: 1qqc (more details), 2.6 Å
PDB Description: crystal structure of an archaebacterial dna polymerase d.tok
SCOP Domain Sequences for d1qqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqca1 c.55.3.5 (A:1-347) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Thermophilic archaebacterium (Desulfurococcus tok)}
mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
lidrglipmegdeelrmlafdietlyhegeefgegpilmisyadeegarvitwknidlpy
vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpkekvyaeeiarawe
sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrs
SCOP Domain Coordinates for d1qqca1:
Click to download the PDB-style file with coordinates for d1qqca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qqca1:
- d1qqca1 appears in SCOP 1.57
- d1qqca1 appears in the current release, SCOPe 2.08
View in 3D
