SCOPe 2.06: Domain d5ls1a1: 5ls1 A:18-223

Lineage for d5ls1a1 (5ls1 A:18-223)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (141 PDB entries)

8. Domain d5ls1a1: 5ls1 A:18-223 [337196]
   Other proteins in same PDB: d5ls1a2
   automated match to d2xjxa_
   complexed with 73z

Details for d5ls1a1

PDB Entry: 5ls1, 1.85 Å

PDB Description: crystal structure of hsp90 in complex with sar166475

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5ls1a1:

Sequence; same for both SEQRES and ATOM records:

>d5ls1a1 d.122.1.1 (A:18-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkelh
inlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgvg
fysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqtey
leerrikeivkkhsqfigypitlfve

Timeline for d5ls1a1:

• d5ls1a1 is new in SCOPe 2.06-stable
  
• d5ls1a1 appears in SCOPe 2.07
  
• d5ls1a1 appears in the current release, SCOPe 2.08